![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
![]() | Domain d4cc4d1: 4cc4 D:1515-1577 [228584] Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4a3, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4d2, d4cc4e1, d4cc4e2, d4cc4f2, d4cc4f3 automated match to d2xmfa_ complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4d1 b.34.2.0 (D:1515-1577) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkt eyt
Timeline for d4cc4d1: