SCOPe 2.08: Domain d4khze_: 4khz E:

Lineage for d4khze_ (4khz E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries)

8. Domain d4khze_: 4khz E: [228475]
   Other proteins in same PDB: d4khza1, d4khza2, d4khzb1, d4khzb2, d4khzf1, d4khzf2, d4khzg_
   automated match to d3rlfe_
   complexed with pgv
   has additional insertions and/or extensions that are not grouped together

Details for d4khze_

PDB Entry: 4khz, 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose

PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d4khze_:

Sequence; same for both SEQRES and ATOM records:

>d4khze_ c.94.1.1 (E:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

Timeline for d4khze_:

• d4khze_ first appeared in SCOPe 2.03
  
• d4khze_ appears in SCOPe 2.07