![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
![]() | Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries) |
![]() | Domain d4khze_: 4khz E: [228475] Other proteins in same PDB: d4khza1, d4khza2, d4khzb1, d4khzb2, d4khzf1, d4khzf2, d4khzg_ automated match to d3rlfe_ complexed with pgv has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4khz (more details), 2.9 Å
SCOPe Domain Sequences for d4khze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4khze_ c.94.1.1 (E:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtritk
Timeline for d4khze_: