Lineage for d4khzf2 (4khz F:261-505)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029031Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 3029032Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 3029033Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 3029043Protein Maltose transport system permease protein MalF [161106] (1 species)
  7. 3029044Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
    Uniprot P02916 261-504
  8. 3029050Domain d4khzf2: 4khz F:261-505 [228474]
    Other proteins in same PDB: d4khza1, d4khza2, d4khzb1, d4khzb2, d4khze_, d4khzf1, d4khzg_
    automated match to d2r6gf2
    complexed with pgv

Details for d4khzf2

PDB Entry: 4khz (more details), 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d4khzf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4khzf2 f.58.1.1 (F:261-505) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
laivn

SCOPe Domain Coordinates for d4khzf2:

Click to download the PDB-style file with coordinates for d4khzf2.
(The format of our PDB-style files is described here.)

Timeline for d4khzf2: