Lineage for d3pclr_ (3pcl R:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10679Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 10680Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 protein domains)
  6. 10789Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 10796Species Pseudomonas aeruginosa [TaxId:287] [49490] (15 PDB entries)
  8. 10874Domain d3pclr_: 3pcl R: [22813]
    Other proteins in same PDB: d3pcla_, d3pclb_, d3pclc_, d3pcld_, d3pcle_, d3pclf_

Details for d3pclr_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide

SCOP Domain Sequences for d3pclr_:

Sequence, based on SEQRES records: (download)

>d3pclr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pclr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pclr_:

Click to download the PDB-style file with coordinates for d3pclr_.
(The format of our PDB-style files is described here.)

Timeline for d3pclr_: