SCOPe 2.06: Domain d4b96a1: 4b96 A:4-151

Lineage for d4b96a1 (4b96 A:4-151)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (9 species)
   not a true protein

7. Species Clostridium clariflavum [TaxId:288965] [227912] (1 PDB entry)

8. Domain d4b96a1: 4b96 A:4-151 [227913]
   Other proteins in same PDB: d4b96a2
   automated match to d4b9fb_
   complexed with ca, cl

Details for d4b96a1

PDB Entry: 4b96, 1.91 Å

PDB Description: Family 3b carbohydrate-binding module from the biomass sensoring system of Clostridium clariflavum

PDB Compounds: (A:) cellulose binding domain-containing protein

SCOPe Domain Sequences for d4b96a1:

Sequence; same for both SEQRES and ATOM records:

>d4b96a1 b.2.2.0 (A:4-151) automated matches {Clostridium clariflavum [TaxId: 288965]}
ilklkhyneqqslyskairwdfvientgnsyidlrnvkvryyfkddykninfavyfyslg
dekndvkgkvynirqsdsshkylevtfekgsippgdaawvfgaitrddwtefnqeddwsf
lqgnstfsywdkmtvyisdklvwgiepy

Timeline for d4b96a1:

• d4b96a1 first appeared in SCOPe 2.03, called d4b96a_
  
• d4b96a1 was called d4b96a_ in SCOPe 2.05
  
• d4b96a1 appears in SCOPe 2.07
  
• d4b96a1 appears in the current release, SCOPe 2.08