PDB entry 4b96

View 4b96 on RCSB PDB site
Description: Family 3b carbohydrate-binding module from the biomass sensoring system of Clostridium clariflavum
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate binding protein system, cellulose
Deposited on 2012-09-02, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.1546
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellulose binding domain-containing protein
  Species: CLOSTRIDIUM CLARIFLAVUM [TaxId:288965]
  Database cross-references and differences (RAF-indexed):
  • Uniprot G8LST1 (3-150)
    • expression tag (0-2)
  Domains in SCOPe 2.06: d4b96a1, d4b96a2
• Heterogens: CL, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4b96A (A:)
  shmilklkhyneqqslyskairwdfvientgnsyidlrnvkvryyfkddykninfavyfy
  slgdekndvkgkvynirqsdsshkylevtfekgsippgdaawvfgaitrddwtefnqedd
  wsflqgnstfsywdkmtvyisdklvwgiepy