| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
| Protein automated matches [191113] (13 species) not a true protein |
| Species Clostridium clariflavum [TaxId:288965] [227912] (1 PDB entry) |
| Domain d4b96a1: 4b96 A:4-151 [227913] Other proteins in same PDB: d4b96a2 automated match to d4b9fb_ complexed with ca, cl |
PDB Entry: 4b96 (more details), 1.91 Å
SCOPe Domain Sequences for d4b96a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b96a1 b.2.2.0 (A:4-151) automated matches {Clostridium clariflavum [TaxId: 288965]}
ilklkhyneqqslyskairwdfvientgnsyidlrnvkvryyfkddykninfavyfyslg
dekndvkgkvynirqsdsshkylevtfekgsippgdaawvfgaitrddwtefnqeddwsf
lqgnstfsywdkmtvyisdklvwgiepy
Timeline for d4b96a1: