Lineage for d4b96a1 (4b96 A:4-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767389Species Clostridium clariflavum [TaxId:288965] [227912] (1 PDB entry)
  8. 2767390Domain d4b96a1: 4b96 A:4-151 [227913]
    Other proteins in same PDB: d4b96a2
    automated match to d4b9fb_
    complexed with ca, cl

Details for d4b96a1

PDB Entry: 4b96 (more details), 1.91 Å

PDB Description: Family 3b carbohydrate-binding module from the biomass sensoring system of Clostridium clariflavum
PDB Compounds: (A:) cellulose binding domain-containing protein

SCOPe Domain Sequences for d4b96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b96a1 b.2.2.0 (A:4-151) automated matches {Clostridium clariflavum [TaxId: 288965]}
ilklkhyneqqslyskairwdfvientgnsyidlrnvkvryyfkddykninfavyfyslg
dekndvkgkvynirqsdsshkylevtfekgsippgdaawvfgaitrddwtefnqeddwsf
lqgnstfsywdkmtvyisdklvwgiepy

SCOPe Domain Coordinates for d4b96a1:

Click to download the PDB-style file with coordinates for d4b96a1.
(The format of our PDB-style files is described here.)

Timeline for d4b96a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b96a2