Lineage for d4jyul_ (4jyu L:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Coagulation factor VIIa [57201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
Uniprot P08709 108-202 ! Uniprot P08709 107-202
Domain d4jyul_: 4jyu L: [227550]
Other proteins in same PDB: d4jyuh_
automated match to d1w7xl_
complexed with 1ok, ca, gol, so4
Details for d4jyul_
PDB Entry: 4jyu (more details), 1.8 Å
PDB Description: structure of factor viia in complex with the inhibitor (2r)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-(phenylsulfonyl)ethanamide
PDB Compounds: (L:) Factor VII heavy chainSCOPe Domain Sequences for d4jyul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyul_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
SCOPe Domain Coordinates for d4jyul_:
Click to download the PDB-style file with coordinates for d4jyul_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jyul_:
- d4jyul_ first appeared in SCOPe 2.03
- d4jyul_ appears in SCOPe 2.07
View in 3D
