Lineage for d3ujna2 (3ujn A:153-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696341Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family) (S)
  5. 2696342Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)
  6. 2696343Protein FGAM synthase PurL, linker domain [109738] (3 species)
  7. 2696344Species Salmonella enterica [TaxId:90371] [227349] (2 PDB entries)
  8. 2696346Domain d3ujna2: 3ujn A:153-220 [227350]
    Other proteins in same PDB: d3ujna1, d3ujna3, d3ujna4, d3ujna5, d3ujna6, d3ujna7, d3ujna8
    automated match to d1t3ta1
    complexed with adp, mg, so4

Details for d3ujna2

PDB Entry: 3ujn (more details), 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujna2 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella enterica [TaxId: 90371]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

SCOPe Domain Coordinates for d3ujna2:

Click to download the PDB-style file with coordinates for d3ujna2.
(The format of our PDB-style files is described here.)

Timeline for d3ujna2: