SCOPe 2.03: Domain d3ujna2: 3ujn A:153-220

Lineage for d3ujna2 (3ujn A:153-220)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family)

5. Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)

6. Protein FGAM synthase PurL, linker domain [109738] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227349] (2 PDB entries)

8. Domain d3ujna2: 3ujn A:153-220 [227350]
   Other proteins in same PDB: d3ujna1, d3ujna3, d3ujna4, d3ujna5, d3ujna6, d3ujna7
   automated match to d1t3ta1
   complexed with adp, mg, so4

Details for d3ujna2

PDB Entry: 3ujn, 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna2:

Sequence; same for both SEQRES and ATOM records:

>d3ujna2 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella enterica [TaxId: 90371]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

Timeline for d3ujna2:

• d3ujna2 is new in SCOPe 2.03-stable
  
• d3ujna2 appears in SCOPe 2.04
  
• d3ujna2 appears in the current release, SCOPe 2.08