Lineage for d3ujna3 (3ujn A:221-429)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421161Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1421162Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1421172Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)
  7. 1421173Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries)
  8. 1421176Domain d3ujna3: 3ujn A:221-429 [227352]
    Other proteins in same PDB: d3ujna1, d3ujna2, d3ujna4, d3ujna6, d3ujna7
    automated match to d1t3ta4
    complexed with adp, mg, so4

Details for d3ujna3

PDB Entry: 3ujn (more details), 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujna3 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry
dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl
ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn
geelrgyhkpimlaggigniradhvqkge

SCOPe Domain Coordinates for d3ujna3:

Click to download the PDB-style file with coordinates for d3ujna3.
(The format of our PDB-style files is described here.)

Timeline for d3ujna3: