![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.284.1: PurS-like [82697] (3 families) ![]() segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
![]() | Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein) duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer |
![]() | Protein FGAM synthase PurL, PurS-like domain [111003] (3 species) |
![]() | Species Salmonella enterica [TaxId:90371] [227347] (2 PDB entries) |
![]() | Domain d3ujna1: 3ujn A:1-152 [227348] Other proteins in same PDB: d3ujna2, d3ujna3, d3ujna4, d3ujna5, d3ujna6, d3ujna7, d3ujna8 automated match to d1t3ta3 complexed with adp, mg, so4 |
PDB Entry: 3ujn (more details), 2.98 Å
SCOPe Domain Sequences for d3ujna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ujna1 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella enterica [TaxId: 90371]} mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt aeqwrqvaaelhdrmmetvfssltdaeklfih
Timeline for d3ujna1: