Lineage for d3pcnd_ (3pcn D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10679Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 10680Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 10691Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
  7. 10698Species Pseudomonas aeruginosa [TaxId:287] [49487] (15 PDB entries)
  8. 10786Domain d3pcnd_: 3pcn D: [22728]
    Other proteins in same PDB: d3pcnm_, d3pcnn_, d3pcno_, d3pcnp_, d3pcnq_, d3pcnr_

Details for d3pcnd_

PDB Entry: 3pcn (more details), 2.4 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3,4-dihydroxyphenylacetate

SCOP Domain Sequences for d3pcnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcnd_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pcnd_:

Click to download the PDB-style file with coordinates for d3pcnd_.
(The format of our PDB-style files is described here.)

Timeline for d3pcnd_: