SCOP 1.63: Domain d1qaba_: 1qab A:

Lineage for d1qaba_ (1qab A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (44 PDB entries)

8. Domain d1qaba_: 1qab A: [22615]
   Other proteins in same PDB: d1qabe_, d1qabf_

Details for d1qaba_

PDB Entry: 1qab, 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

SCOP Domain Sequences for d1qaba_:

Sequence; same for both SEQRES and ATOM records:

>d1qaba_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtn

Timeline for d1qaba_:

• d1qaba_ first appeared (with stable ids) in SCOP 1.55
  
• d1qaba_ appears in SCOP 1.61
  
• d1qaba_ appears in SCOP 1.65
  
• d1qaba_ appears in the current release, SCOPe 2.08