Lineage for d1qaba_ (1qab A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10575Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 10576Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 10577Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 10581Species Human (Homo sapiens) [TaxId:9606] [49475] (35 PDB entries)
  8. 10658Domain d1qaba_: 1qab A: [22615]
    Other proteins in same PDB: d1qabe_, d1qabf_

Details for d1qaba_

PDB Entry: 1qab (more details), 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

SCOP Domain Sequences for d1qaba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaba_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtn

SCOP Domain Coordinates for d1qaba_:

Click to download the PDB-style file with coordinates for d1qaba_.
(The format of our PDB-style files is described here.)

Timeline for d1qaba_: