Lineage for d1qhoa2 (1qho A:577-686)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939144Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 939145Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 939181Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
    this domain is the last one in the protein chain
  7. 939242Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)
  8. 939243Domain d1qhoa2: 1qho A:577-686 [22513]
    Other proteins in same PDB: d1qhoa1, d1qhoa3, d1qhoa4
    complexed with abd, ca, mal, so4

Details for d1qhoa2

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

SCOPe Domain Coordinates for d1qhoa2:

Click to download the PDB-style file with coordinates for d1qhoa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa2: