Lineage for d1qhoa2 (1qho A:577-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10550Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)
  8. 10551Domain d1qhoa2: 1qho A:577-686 [22513]
    Other proteins in same PDB: d1qhoa1, d1qhoa3, d1qhoa4

Details for d1qhoa2

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

SCOP Domain Sequences for d1qhoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

SCOP Domain Coordinates for d1qhoa2:

Click to download the PDB-style file with coordinates for d1qhoa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa2: