Lineage for d1qhoa1 (1qho A:496-576)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937708Protein Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D [81280] (1 species)
    domain architecture similar to cyclomaltodextrin glycosylhydrolases
  7. 937709Species Bacillus stearothermophilus [TaxId:1422] [81281] (2 PDB entries)
  8. 937710Domain d1qhoa1: 1qho A:496-576 [21844]
    Other proteins in same PDB: d1qhoa2, d1qhoa3, d1qhoa4
    complexed with abd, ca, mal, so4

Details for d1qhoa1

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]}
asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa
gltdvkvtaggvssnlysyni

SCOPe Domain Coordinates for d1qhoa1:

Click to download the PDB-style file with coordinates for d1qhoa1.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa1: