![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain [49452] (1 family) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries) |
![]() | Domain d1cxi_2: 1cxi 582-686 [22487] Other proteins in same PDB: d1cxi_1, d1cxi_3, d1cxi_4 complexed with ca, mal |
PDB Entry: 1cxi (more details), 2.2 Å
SCOP Domain Sequences for d1cxi_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxi_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1cxi_2: