SCOP 1.63: Domain d1cxi_1: 1cxi 496-581

Lineage for d1cxi_1 (1cxi 496-581)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d1cxi_1: 1cxi 496-581 [21818]
   Other proteins in same PDB: d1cxi_2, d1cxi_3, d1cxi_4
   complexed with ca, mal

Details for d1cxi_1

PDB Entry: 1cxi, 2.2 Å

PDB Description: wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55

SCOP Domain Sequences for d1cxi_1:

Sequence; same for both SEQRES and ATOM records:

>d1cxi_1 b.1.18.2 (496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

Timeline for d1cxi_1:

• d1cxi_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cxi_1 appears in SCOP 1.61
  
• d1cxi_1 appears in SCOP 1.65
  
• d1cxi_1 appears in the current release, SCOPe 2.08, called d1cxia1