| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.1: SufE-like [82650] (3 proteins) Fe-S metabolism associated domain automatically mapped to Pfam PF02657 |
| Protein automated matches [191012] (4 species) not a true protein |
| Species Escherichia coli [TaxId:714962] [226747] (1 PDB entry) |
| Domain d4lw4c_: 4lw4 C: [224774] Other proteins in same PDB: d4lw4a_, d4lw4b_ automated match to d1ni7a_ complexed with plp |
PDB Entry: 4lw4 (more details), 2.01 Å
SCOPe Domain Sequences for d4lw4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lw4c_ d.224.1.1 (C:) automated matches {Escherichia coli [TaxId: 714962]}
npqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagce
nrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglr
aqlsasrsqglnalseaiiaaakqv
Timeline for d4lw4c_: