Lineage for d1ni7a_ (1ni7 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945491Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1945492Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1945493Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 1945494Protein Hypothetical protein YgdK [89912] (1 species)
  7. 1945495Species Escherichia coli [TaxId:562] [89913] (1 PDB entry)
  8. 1945496Domain d1ni7a_: 1ni7 A: [85738]
    structural genomics; NESG target ER75

Details for d1ni7a_

PDB Entry: 1ni7 (more details)

PDB Description: northeast structural genomic consortium target er75
PDB Compounds: (A:) Hypothetical protein ygdK

SCOPe Domain Sequences for d1ni7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni7a_ d.224.1.1 (A:) Hypothetical protein YgdK {Escherichia coli [TaxId: 562]}
mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
lraqlsasrsqglnalseaiiaatkqvle

SCOPe Domain Coordinates for d1ni7a_:

Click to download the PDB-style file with coordinates for d1ni7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ni7a_: