Lineage for d4lw4c_ (4lw4 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446741Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1446742Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1446743Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 1446751Protein automated matches [191012] (2 species)
    not a true protein
  7. 1446752Species Escherichia coli [TaxId:714962] [226747] (1 PDB entry)
  8. 1446753Domain d4lw4c_: 4lw4 C: [224774]
    Other proteins in same PDB: d4lw4a_, d4lw4b_
    automated match to d1ni7a_
    complexed with plp

Details for d4lw4c_

PDB Entry: 4lw4 (more details), 2.01 Å

PDB Description: structural changes during cysteine desulfurase csda and sulfur- acceptor csde interactions provide insight into the trans- persulfuration
PDB Compounds: (C:) Cysteine desulfuration protein CsdE

SCOPe Domain Sequences for d4lw4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lw4c_ d.224.1.1 (C:) automated matches {Escherichia coli [TaxId: 714962]}
npqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagce
nrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglr
aqlsasrsqglnalseaiiaaakqv

SCOPe Domain Coordinates for d4lw4c_:

Click to download the PDB-style file with coordinates for d4lw4c_.
(The format of our PDB-style files is described here.)

Timeline for d4lw4c_: