Lineage for d4lroa_ (4lro A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681285Protein automated matches [190420] (8 species)
    not a true protein
  7. 1681308Species Momordica balsamina [TaxId:3672] [189375] (55 PDB entries)
  8. 1681340Domain d4lroa_: 4lro A: [224751]
    automated match to d3mrwa_
    complexed with gol, nag, spd

Details for d4lroa_

PDB Entry: 4lro (more details), 1.98 Å

PDB Description: crystal structure of spermidine inhibited ribosome inactivating protein from momordica balsamina
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4lroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lroa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4lroa_:

Click to download the PDB-style file with coordinates for d4lroa_.
(The format of our PDB-style files is described here.)

Timeline for d4lroa_: