Lineage for d4kgid2 (4kgi D:81-200)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1271151Protein automated matches [226848] (9 species)
    not a true protein
  7. 1271250Species Shigella flexneri [TaxId:198215] [226693] (1 PDB entry)
  8. 1271254Domain d4kgid2: 4kgi D:81-200 [224293]
    Other proteins in same PDB: d4kgia1, d4kgib1, d4kgic1, d4kgid1
    automated match to d1n2aa1
    complexed with gsh

Details for d4kgid2

PDB Entry: 4kgi (more details), 1.6 Å

PDB Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d4kgid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgid2 a.45.1.1 (D:81-200) automated matches {Shigella flexneri [TaxId: 198215]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqldkklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl

SCOPe Domain Coordinates for d4kgid2:

Click to download the PDB-style file with coordinates for d4kgid2.
(The format of our PDB-style files is described here.)

Timeline for d4kgid2: