Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Shigella flexneri [TaxId:198215] [226692] (1 PDB entry) |
Domain d4kgia1: 4kgi A:1-80 [224286] Other proteins in same PDB: d4kgia2, d4kgib2, d4kgic2, d4kgid2 automated match to d1n2aa2 complexed with gsh |
PDB Entry: 4kgi (more details), 1.6 Å
SCOPe Domain Sequences for d4kgia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgia1 c.47.1.0 (A:1-80) automated matches {Shigella flexneri [TaxId: 198215]} mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpalllddg tlltegvaimqyladsvpdr
Timeline for d4kgia1: