SCOPe 2.04: Domain d4kgia1: 4kgi A:1-80

Lineage for d4kgia1 (4kgi A:1-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Shigella flexneri [TaxId:198215] [226692] (1 PDB entry)

8. Domain d4kgia1: 4kgi A:1-80 [224286]
   Other proteins in same PDB: d4kgia2, d4kgib2, d4kgic2, d4kgid2
   automated match to d1n2aa2
   complexed with gsh

Details for d4kgia1

PDB Entry: 4kgi, 1.6 Å

PDB Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4kgia1:

Sequence; same for both SEQRES and ATOM records:

>d4kgia1 c.47.1.0 (A:1-80) automated matches {Shigella flexneri [TaxId: 198215]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpalllddg
tlltegvaimqyladsvpdr

Timeline for d4kgia1:

• d4kgia1 first appeared in SCOPe 2.03
  
• d4kgia1 appears in SCOPe 2.05
  
• d4kgia1 appears in the current release, SCOPe 2.08