| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (9 species) not a true protein |
| Species Shigella flexneri [TaxId:198215] [226693] (1 PDB entry) |
| Domain d4kgib2: 4kgi B:81-200 [224289] Other proteins in same PDB: d4kgia1, d4kgib1, d4kgic1, d4kgid1 automated match to d1n2aa1 complexed with gsh |
PDB Entry: 4kgi (more details), 1.6 Å
SCOPe Domain Sequences for d4kgib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgib2 a.45.1.1 (B:81-200) automated matches {Shigella flexneri [TaxId: 198215]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqldkklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
Timeline for d4kgib2: