SCOPe 2.07: Domain d4kaaa1: 4kaa A:13-304

Lineage for d4kaaa1 (4kaa A:13-304)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (13 PDB entries)

8. Domain d4kaaa1: 4kaa A:13-304 [224233]
   Other proteins in same PDB: d4kaaa2, d4kaab2
   automated match to d4kaca_
   complexed with na, peg

Details for d4kaaa1

PDB Entry: 4kaa, 2.28 Å

PDB Description: Crystal structure of the halotag2 protein at the resolution 2.3A, Northeast Structural Genomics Consortium (NESG) target OR150

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4kaaa1:

Sequence; same for both SEQRES and ATOM records:

>d4kaaa1 c.69.1.8 (A:13-304) automated matches {Rhodococcus sp. [TaxId: 1831]}
seigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrc
iapdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnpe
rvkgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegalpmgvvrpl
tevemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwg
tpgvlippaeaarlaeslpncktvdigpglfllqednpdligseiarwlpgl

Timeline for d4kaaa1:

• d4kaaa1 first appeared in SCOPe 2.03, called d4kaaa_
  
• d4kaaa1 appears in SCOPe 2.06
  
• d4kaaa1 appears in the current release, SCOPe 2.08