SCOPe 2.04: Domain d4jfrb1: 4jfr B:-5-152

Lineage for d4jfrb1 (4jfr B:-5-152)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)

8. Domain d4jfrb1: 4jfr B:-5-152 [223792]
   automated match to d1duvg1
   complexed with cl, cp, mg

Details for d4jfrb1

PDB Entry: 4jfr, 2.17 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate

PDB Compounds: (B:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jfrb1:

Sequence; same for both SEQRES and ATOM records:

>d4jfrb1 c.78.1.0 (B:-5-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
yfqsnamafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialife
kastrtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqai
veelgafagvpvwngltdefhptqiladfltmlehsqg

Timeline for d4jfrb1:

• d4jfrb1 first appeared in SCOPe 2.03
  
• d4jfrb1 appears in SCOPe 2.05
  
• d4jfrb1 appears in the current release, SCOPe 2.08