![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (22 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries) |
![]() | Domain d4jfra1: 4jfr A:-1-152 [223790] automated match to d1duvg1 complexed with cl, cp, mg |
PDB Entry: 4jfr (more details), 2.17 Å
SCOPe Domain Sequences for d4jfra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfra1 c.78.1.0 (A:-1-152) automated matches {Vibrio vulnificus [TaxId: 216895]} namafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekast rtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveel gafagvpvwngltdefhptqiladfltmlehsqg
Timeline for d4jfra1:
![]() Domains from other chains: (mouse over for more information) d4jfrb1, d4jfrb2, d4jfrc1, d4jfrc2 |