Lineage for d4jdsc1 (4jds C:117-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813072Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2813073Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2813074Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2813075Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2813081Domain d4jdsc1: 4jds C:117-193 [223758]
    Other proteins in same PDB: d4jdsa2, d4jdsa3, d4jdsb2, d4jdsb3, d4jdsc2, d4jdsc3, d4jdsd2, d4jdsd3
    automated match to d1n6ca1
    complexed with 1l4, sam, unx

    fragment; missing more than one-third of the common structure and/or sequence

Details for d4jdsc1

PDB Entry: 4jds (more details), 1.7 Å

PDB Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine
PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jdsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jdsc1 b.76.2.1 (C:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOPe Domain Coordinates for d4jdsc1:

Click to download the PDB-style file with coordinates for d4jdsc1.
(The format of our PDB-style files is described here.)

Timeline for d4jdsc1: