SCOPe 2.08: Domain d4jdsd2: 4jds D:194-366

Lineage for d4jdsd2 (4jds D:194-366)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core
   Pfam PF00856

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d4jdsd2: 4jds D:194-366 [223761]
   Other proteins in same PDB: d4jdsa1, d4jdsa3, d4jdsb1, d4jdsb3, d4jdsc1, d4jdsc3, d4jdsd1, d4jdsd3
   automated match to d3cbpa2
   complexed with 1l4, sam, unx

Details for d4jdsd2

PDB Entry: 4jds, 1.7 Å

PDB Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine

PDB Compounds: (D:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jdsd2:

Sequence, based on SEQRES records:

>d4jdsd2 b.85.7.1 (D:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk

Sequence, based on observed residues (ATOM records):

>d4jdsd2 b.85.7.1 (D:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprfg
pikcirtlraveadeeltvaygydeapewyqvelkafqatqqk

Timeline for d4jdsd2:

• d4jdsd2 first appeared in SCOPe 2.03
  
• d4jdsd2 appears in SCOPe 2.07