Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains |
Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries) Uniprot Q8WTS6 52-336 |
Domain d4jdsd2: 4jds D:194-366 [223761] Other proteins in same PDB: d4jdsa1, d4jdsa3, d4jdsb1, d4jdsb3, d4jdsc1, d4jdsc3, d4jdsd1, d4jdsd3 automated match to d3cbpa2 complexed with 1l4, sam, unx |
PDB Entry: 4jds (more details), 1.7 Å
SCOPe Domain Sequences for d4jdsd2:
Sequence, based on SEQRES records: (download)
>d4jdsd2 b.85.7.1 (D:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk
>d4jdsd2 b.85.7.1 (D:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprfg pikcirtlraveadeeltvaygydeapewyqvelkafqatqqk
Timeline for d4jdsd2: