Lineage for d4jdsa2 (4jds A:194-366)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818607Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains
  6. 2818613Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 2818614Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 2818618Domain d4jdsa2: 4jds A:194-366 [223755]
    Other proteins in same PDB: d4jdsa1, d4jdsa3, d4jdsb1, d4jdsb3, d4jdsc1, d4jdsc3, d4jdsd1, d4jdsd3
    automated match to d3cbpa2
    complexed with 1l4, sam, unx

Details for d4jdsa2

PDB Entry: 4jds (more details), 1.7 Å

PDB Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jdsa2:

Sequence, based on SEQRES records: (download)

>d4jdsa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk

Sequence, based on observed residues (ATOM records): (download)

>d4jdsa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydeapewyqvelkafqatqqk

SCOPe Domain Coordinates for d4jdsa2:

Click to download the PDB-style file with coordinates for d4jdsa2.
(The format of our PDB-style files is described here.)

Timeline for d4jdsa2: