Lineage for d1n6ca1 (1n6c A:79-193)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 
11+ stranded sheet partly folded upon itself at the C-endFamily b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
Uniprot Q8WTS6 52-366
Domain d1n6ca1: 1n6c A:79-193 [80123]
Other proteins in same PDB: d1n6ca2
truncated from N-terminus
complexed with sam
Details for d1n6ca1
PDB Entry: 1n6c (more details), 2.3 Å
PDB Description: Structure of SET7/9
PDB Compounds: (A:) SET domain-containing protein 7SCOPe Domain Sequences for d1n6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ca1 b.76.2.1 (A:79-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedge
mtgekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhf
SCOPe Domain Coordinates for d1n6ca1:
Click to download the PDB-style file with coordinates for d1n6ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n6ca1:
- d1n6ca1 first appeared in SCOP 1.63
- d1n6ca1 appears in SCOPe 2.07
View in 3D
