![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
![]() | Protein Periplasmic chaperone FimC [49358] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49359] (6 PDB entries) |
![]() | Domain d1qung1: 1qun G:1-121 [22327] Other proteins in same PDB: d1quna2, d1qunb1, d1qunb2, d1qunc2, d1qund1, d1qund2, d1qune2, d1qunf1, d1qunf2, d1qung2, d1qunh1, d1qunh2, d1quni2, d1qunj1, d1qunj2, d1qunk2, d1qunl1, d1qunl2, d1qunm2, d1qunn1, d1qunn2, d1quno2, d1qunp1, d1qunp2 |
PDB Entry: 1qun (more details), 2.8 Å
SCOPe Domain Sequences for d1qung1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qung1 b.1.11.1 (G:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d1qung1:
![]() Domains from other chains: (mouse over for more information) d1quna1, d1quna2, d1qunb1, d1qunb2, d1qunc1, d1qunc2, d1qund1, d1qund2, d1qune1, d1qune2, d1qunf1, d1qunf2, d1qunh1, d1qunh2, d1quni1, d1quni2, d1qunj1, d1qunj2, d1qunk1, d1qunk2, d1qunl1, d1qunl2, d1qunm1, d1qunm2, d1qunn1, d1qunn2, d1quno1, d1quno2, d1qunp1, d1qunp2 |