Lineage for d1qunf2 (1qun F:159-279)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112726Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1112727Species Escherichia coli [TaxId:562] [49407] (14 PDB entries)
  8. 1112771Domain d1qunf2: 1qun F:159-279 [22416]
    Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunf2

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
PDB Compounds: (F:) mannose-specific adhesin fimh

SCOPe Domain Sequences for d1qunf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qunf2 b.2.3.2 (F:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d1qunf2:

Click to download the PDB-style file with coordinates for d1qunf2.
(The format of our PDB-style files is described here.)

Timeline for d1qunf2: