![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
![]() | Protein Mannose-specific adhesin FimH [49406] (1 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
![]() | Species Escherichia coli [TaxId:562] [49407] (14 PDB entries) |
![]() | Domain d1qunl2: 1qun L:159-279 [22422] Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2 |
PDB Entry: 1qun (more details), 2.8 Å
SCOPe Domain Sequences for d1qunl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qunl2 b.2.3.2 (L:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy q
Timeline for d1qunl2:
![]() Domains from other chains: (mouse over for more information) d1quna1, d1quna2, d1qunb1, d1qunb2, d1qunc1, d1qunc2, d1qund1, d1qund2, d1qune1, d1qune2, d1qunf1, d1qunf2, d1qung1, d1qung2, d1qunh1, d1qunh2, d1quni1, d1quni2, d1qunj1, d1qunj2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1qunn1, d1qunn2, d1quno1, d1quno2, d1qunp1, d1qunp2 |