Lineage for d4ii5b2 (4ii5 B:310-430)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003844Protein automated matches [227027] (3 species)
    not a true protein
  7. 2003895Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries)
  8. 2003901Domain d4ii5b2: 4ii5 B:310-430 [223186]
    Other proteins in same PDB: d4ii5a_, d4ii5c_
    automated match to d1oiub2
    complexed with adp, gol, mg

Details for d4ii5b2

PDB Entry: 4ii5 (more details), 2.15 Å

PDB Description: structure of pcdk2/cyclina bound to adp and 1 magnesium ion
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4ii5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ii5b2 a.74.1.1 (B:310-430) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvnqfltqyflhlqpanckveslamflgelslidadpylkylpsliagaafhlalytvtg
qswpeslaqqtgytleslkpclvdlhqtylkapqhaqqsirekykhskyhsvsllnppet
l

SCOPe Domain Coordinates for d4ii5b2:

Click to download the PDB-style file with coordinates for d4ii5b2.
(The format of our PDB-style files is described here.)

Timeline for d4ii5b2: