SCOPe 2.03: Domain d4ii5b2: 4ii5 B:310-430

Lineage for d4ii5b2 (4ii5 B:310-430)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries)

8. Domain d4ii5b2: 4ii5 B:310-430 [223186]
   Other proteins in same PDB: d4ii5a_, d4ii5c_
   automated match to d1oiub2
   complexed with adp, gol, mg

Details for d4ii5b2

PDB Entry: 4ii5, 2.15 Å

PDB Description: structure of pcdk2/cyclina bound to adp and 1 magnesium ion

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4ii5b2:

Sequence; same for both SEQRES and ATOM records:

>d4ii5b2 a.74.1.1 (B:310-430) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvnqfltqyflhlqpanckveslamflgelslidadpylkylpsliagaafhlalytvtg
qswpeslaqqtgytleslkpclvdlhqtylkapqhaqqsirekykhskyhsvsllnppet
l

Timeline for d4ii5b2:

• d4ii5b2 is new in SCOPe 2.03-stable
  
• d4ii5b2 appears in SCOPe 2.04
  
• d4ii5b2 appears in the current release, SCOPe 2.08