Lineage for d4i8xf2 (4i8x F:160-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)
  8. 2999424Domain d4i8xf2: 4i8x F:160-331 [223027]
    Other proteins in same PDB: d4i8xa1, d4i8xb1, d4i8xc1, d4i8xd1, d4i8xe1, d4i8xf1, d4i8xg1, d4i8xh1
    automated match to d9ldta2
    complexed with 6p3

Details for d4i8xf2

PDB Entry: 4i8x (more details), 2.23 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP27460
PDB Compounds: (F:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i8xf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i8xf2 d.162.1.1 (F:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4i8xf2:

Click to download the PDB-style file with coordinates for d4i8xf2.
(The format of our PDB-style files is described here.)

Timeline for d4i8xf2: