SCOPe 2.08: Domain d4i8xf2: 4i8x F:160-331

Lineage for d4i8xf2 (4i8x F:160-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)

8. Domain d4i8xf2: 4i8x F:160-331 [223027]
   Other proteins in same PDB: d4i8xa1, d4i8xb1, d4i8xc1, d4i8xd1, d4i8xe1, d4i8xf1, d4i8xg1, d4i8xh1
   automated match to d9ldta2
   complexed with 6p3

Details for d4i8xf2

PDB Entry: 4i8x, 2.23 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP27460

PDB Compounds: (F:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i8xf2:

Sequence; same for both SEQRES and ATOM records:

>d4i8xf2 d.162.1.1 (F:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

Timeline for d4i8xf2:

• d4i8xf2 first appeared in SCOPe 2.03
  
• d4i8xf2 appears in SCOPe 2.07