| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein automated matches [226881] (8 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries) |
| Domain d4i8xg1: 4i8x G:1-159 [223028] Other proteins in same PDB: d4i8xa2, d4i8xb2, d4i8xc2, d4i8xd2, d4i8xe2, d4i8xf2, d4i8xg2, d4i8xh2 automated match to d9ldta1 complexed with 6p3 |
PDB Entry: 4i8x (more details), 2.23 Å
SCOPe Domain Sequences for d4i8xg1:
Sequence, based on SEQRES records: (download)
>d4i8xg1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
>d4i8xg1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqesrlnlvqrnvnifkfiipnv
vkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d4i8xg1: