PDB entry 4i8x

View 4i8x on RCSB PDB site
Description: Crystal structure of rabbit LDHA in complex with AP27460
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: fragment, inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-04, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xa1, d4i8xa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xb1, d4i8xb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xc1, d4i8xc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xd1, d4i8xd2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xe1, d4i8xe2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xf1, d4i8xf2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xg1, d4i8xg2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8xh1, d4i8xh2
  • Heterogens: 6P3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i8xA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8xA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagalvqrnvnifkfiipnvvkysphc
    kllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalschgwilg
    ehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkgyttwa
    iglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkvtltse
    eeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i8xB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i8xC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i8xD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i8xE (E:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i8xF (F:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8xF (F:)
    aalkdqlihnllkevpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemm
    dlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhal
    schgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevik
    lkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdv
    vkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4i8xG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8xG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqesrlnlvqrnvnifkfiipnv
    vkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhals
    chgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevikl
    kgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvv
    kvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i8xH (H:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf