SCOPe 2.04: Domain d4i5nc_: 4i5n C:

Lineage for d4i5nc_ (4i5n C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
   Uniprot P67775 2-294

8. Domain d4i5nc_: 4i5n C: [222945]
   Other proteins in same PDB: d4i5na_, d4i5nd_
   automated match to d4i5lc_
   complexed with ca, mn

Details for d4i5nc_

PDB Entry: 4i5n, 2.8 Å

PDB Description: structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation

PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha

SCOPe Domain Sequences for d4i5nc_:

Sequence; same for both SEQRES and ATOM records:

>d4i5nc_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpapr

Timeline for d4i5nc_:

• d4i5nc_ first appeared in SCOPe 2.03
  
• d4i5nc_ appears in SCOPe 2.05
  
• d4i5nc_ appears in the current release, SCOPe 2.08