Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries) Uniprot P67775 2-294 |
Domain d4i5nc_: 4i5n C: [222945] Other proteins in same PDB: d4i5na1, d4i5na2, d4i5nd1, d4i5nd2 automated match to d4i5lc_ complexed with ca, mn |
PDB Entry: 4i5n (more details), 2.8 Å
SCOPe Domain Sequences for d4i5nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5nc_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpapr
Timeline for d4i5nc_: