Lineage for d4i5nf_ (4i5n F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1679960Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 1679961Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 1679966Domain d4i5nf_: 4i5n F: [222947]
    Other proteins in same PDB: d4i5na_, d4i5nd_
    automated match to d4i5lc_
    complexed with ca, mn

Details for d4i5nf_

PDB Entry: 4i5n (more details), 2.8 Å

PDB Description: structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
PDB Compounds: (F:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha

SCOPe Domain Sequences for d4i5nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5nf_ d.159.1.3 (F:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqf
hdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrq
itqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhira
ldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahq
lvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaprrg

SCOPe Domain Coordinates for d4i5nf_:

Click to download the PDB-style file with coordinates for d4i5nf_.
(The format of our PDB-style files is described here.)

Timeline for d4i5nf_: