Lineage for d4hlsb_ (4hls B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635688Protein automated matches [191016] (6 species)
    not a true protein
  7. 1635719Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)
  8. 1635721Domain d4hlsb_: 4hls B: [222661]
    automated match to d1xywa_
    complexed with cl, gol, na; mutant

Details for d4hlsb_

PDB Entry: 4hls (more details), 1.45 Å

PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S170N)
PDB Compounds: (B:) major prion protein

SCOPe Domain Sequences for d4hlsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlsb_ d.6.1.1 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

SCOPe Domain Coordinates for d4hlsb_:

Click to download the PDB-style file with coordinates for d4hlsb_.
(The format of our PDB-style files is described here.)

Timeline for d4hlsb_: