SCOPe 2.04: Domain d4hlsb_: 4hls B:

Lineage for d4hlsb_ (4hls B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)

8. Domain d4hlsb_: 4hls B: [222661]
   automated match to d1xywa_
   complexed with cl, gol, na; mutant

Details for d4hlsb_

PDB Entry: 4hls, 1.45 Å

PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S170N)

PDB Compounds: (B:) major prion protein

SCOPe Domain Sequences for d4hlsb_:

Sequence; same for both SEQRES and ATOM records:

>d4hlsb_ d.6.1.1 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

Timeline for d4hlsb_:

• d4hlsb_ first appeared in SCOPe 2.03
  
• d4hlsb_ appears in SCOPe 2.05
  
• d4hlsb_ appears in the current release, SCOPe 2.08