Lineage for d4h2xc1 (4h2x C:1-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993362Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1993425Protein automated matches [190286] (9 species)
    not a true protein
  7. 1993426Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)
  8. 1993431Domain d4h2xc1: 4h2x C:1-76 [222344]
    Other proteins in same PDB: d4h2xc2
    automated match to d2jq4a1
    protein/RNA complex; complexed with cl, g5a, pns, zn

Details for d4h2xc1

PDB Entry: 4h2x (more details), 2.15 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate
PDB Compounds: (C:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2xc1 a.28.1.1 (C:1-76) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvkli

SCOPe Domain Coordinates for d4h2xc1:

Click to download the PDB-style file with coordinates for d4h2xc1.
(The format of our PDB-style files is described here.)

Timeline for d4h2xc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h2xc2
View in 3D
Domains from other chains:
(mouse over for more information)
d4h2xd_