SCOPe 2.08: Domain d4h2xc1: 4h2x C:1-76

Lineage for d4h2xc1 (4h2x C:1-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (9 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)

8. Domain d4h2xc1: 4h2x C:1-76 [222344]
   Other proteins in same PDB: d4h2xc2
   automated match to d2jq4a1
   protein/RNA complex; complexed with cl, g5a, pns, zn

Details for d4h2xc1

PDB Entry: 4h2x, 2.15 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate

PDB Compounds: (C:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2xc1:

Sequence; same for both SEQRES and ATOM records:

>d4h2xc1 a.28.1.1 (C:1-76) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvkli

Timeline for d4h2xc1:

• d4h2xc1 first appeared in SCOPe 2.03, called d4h2xc_
  
• d4h2xc1 appears in SCOPe 2.07