| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein automated matches [190286] (8 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries) |
| Domain d4h2xc_: 4h2x C: [222344] automated match to d2jq4a1 protein/RNA complex; complexed with cl, g5a, pns, zn |
PDB Entry: 4h2x (more details), 2.15 Å
SCOPe Domain Sequences for d4h2xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h2xc_ a.28.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
rksfasikaiedtvkli
Timeline for d4h2xc_: